PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00101928001
Common NameGSBRNA2T00101928001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 369aa    MW: 40849.4 Da    PI: 8.8498
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00101928001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.27.4e-38125183260
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                          ++k l+cprC+s++tkfCyynny++sqPr+fC++C+ryWt+GG++rnvPvG+grrknk 
  GSBRNA2T00101928001 125 PDKLLPCPRCESAHTKFCYYNNYNVSQPRHFCRNCQRYWTAGGSMRNVPVGSGRRKNKG 183
                          78999****************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.0E-31127182IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.5129183IPR003851Zinc finger, Dof-type
ProDomPD0074786.0E-24131182IPR003851Zinc finger, Dof-type
PROSITE patternPS013610131167IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MSKSKDTEIK LFGTTITSLL AVDHHDPSSL SSIHGVSYQS KEPSSSSSSS CCPSTGPNMV  60
LANNHEHGNS RFKGPCILSD LNEPPRAAFE ISSPTSSKTN GDQQSEITTT TTSTSEDKPT  120
TLKKPDKLLP CPRCESAHTK FCYYNNYNVS QPRHFCRNCQ RYWTAGGSMR NVPVGSGRRK  180
NKGWPCSNHY LKVTSEDYEN NNNSGTILSF GSSESSVIET GKHQENKTHQ GFLASQVMLP  240
NNTSPWPYQW SPTGRNTSFY PIPFYWGCTV PMWPTSEASP CLGKRSRDET EVETKNTTLR  300
TSEATKNVVW PKLPTKPEKK MEGGLSLFNG FETKGSNRRS LVPETSINLQ ANPAAMSRSM  360
NFRESMQQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.137280.0leaf| seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00101928001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893530.0AC189353.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB043L15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013698917.10.0PREDICTED: cyclic dof factor 5-like
SwissprotQ9SEZ31e-176CDF5_ARATH; Cyclic dof factor 5
TrEMBLA0A078E5P60.0A0A078E5P6_BRANA; BnaA07g28120D protein
STRINGBra004396.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM130901729
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69570.11e-166Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]